A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10881
Swiss-prot Accession number	P09477 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5755
References	1  PubMed abstract 3556313
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VVPPQHLCGAHLVDALYLVCGERGFFYTPK
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10882
Swiss-prot Accession number	P09477 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5755
References	1  PubMed abstract 3556313
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11117
Swiss-prot Accession number	P68956 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	29 Amino acids
Molecular weight	3508
References	1  PubMed abstract 3556313
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSEGTFSNDYSKYLETRRAQDFVQWLKNS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11139
Swiss-prot Accession number	P21780 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments).
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	73 Amino acids
Molecular weight	7989
References	1  PubMed abstract 2889597
Domain Name	Somatostatin
Hormone Name	[Tyr21,Gly24]-somatostatin-28
Mature Hormone Sequence	SIEPPNNLPPRERKAGCKNFYWKGFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (46-73
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11140
Swiss-prot Accession number	P21780 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments).
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	73 Amino acids
Molecular weight	7989
References	1  PubMed abstract 2889597
Domain Name	Somatostatin
Hormone Name	[Tyr7,Gly10]-somatostatin-14
Mature Hormone Sequence	AGCKNFYWKGFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (60-73)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated